P2X4 Antibody
| Name | P2X4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92239 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YCMKKRLYYREKKYKYVEDYEQGLASELDQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | P2X4 Protein |
| Description | Rabbit Polyclonal |
| Gene | P2RX4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: P2X4 Antibody [NBP1-92239] - Analysis in human cell line SK-MEL-30.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22626_P2X4%2520Antibody-Western%2520Blot-NBP1-92239-img0006.jpg)
![Immunohistochemistry-Paraffin: P2X4 Antibody [NBP1-92239] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/22627_P2X4-Antibody-Immunohistochemistry-Paraffin-NBP1-92239-img0007.jpg)