PTBP2 Antibody
| Name | PTBP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92302 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GQPALDPAIAAAFAKETSLLAVPGALSPLAI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PTBP2 Protein |
| Description | Rabbit Polyclonal |
| Gene | PTBP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PTBP2 Antibody [NBP1-92302] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9923_PTBP2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92302-img0004.jpg)
Immunocytochemistry/Immunofluorescence: PTBP2 Antibody [NBP1-92302] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
![Immunohistochemistry-Paraffin: PTBP2 Antibody [NBP1-92302] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9924_PTBP2-Antibody-Immunohistochemistry-Paraffin-NBP1-92302-img0002.jpg)
Immunohistochemistry-Paraffin: PTBP2 Antibody [NBP1-92302] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.