SHPRH Antibody
| Name | SHPRH Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92387 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KKNPQHLYSFIAKILWRSAKKDVIDQIQIPPQTEEIHWLHFSPVERHFYHRQHEVCCQDVVVKLRKISDWALKLSSLDRRTVTSILYPLL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SHPRH Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SHPRH |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SHPRH Antibody [NBP1-92387] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoskeleton (microtubules).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29029_SHPRH%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92387-img0003.jpg)
Immunocytochemistry/Immunofluorescence: SHPRH Antibody [NBP1-92387] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoskeleton (microtubules).
![Immunohistochemistry-Paraffin: SHPRH Antibody [NBP1-92387] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29030_SHPRH%2520Antibody-Immunohistochemistry-Paraffin-NBP1-92387-img0002.jpg)
Immunohistochemistry-Paraffin: SHPRH Antibody [NBP1-92387] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.