Sphingomyelin Synthase 2 Antibody

Name Sphingomyelin Synthase 2 Antibody
Supplier Novus Biologicals
Catalog NBP1-92436
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:IIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESR
Purity/Format Immunogen affinity purified
Blocking Peptide Sphingomyelin Synthase 2 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SGMS2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.