Symplekin Antibody
| Name | Symplekin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-92464 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PNPPSVLFGADKDTEVAAPWTEETVKQCLYLYLALLPQNHKLIHELAAVYTEAIADIKRTVLRVIEQPIRGMGMNSPELLLLVENCPKGA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Symplekin Protein |
| Description | Rabbit Polyclonal |
| Gene | SYMPK |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Symplekin Antibody [NBP1-92464] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9557_Symplekin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92464-img0004.jpg)
Immunocytochemistry/Immunofluorescence: Symplekin Antibody [NBP1-92464] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.
![Immunohistochemistry-Paraffin: Symplekin Antibody [NBP1-92464] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9558_Symplekin-Antibody-Immunohistochemistry-Paraffin-NBP1-92464-img0002.jpg)
Immunohistochemistry-Paraffin: Symplekin Antibody [NBP1-92464] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.