MYO1G Antibody
| Name | MYO1G Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-93704 |
| Prices | $129.00, $419.00 |
| Sizes | 25 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB Simple Western IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MYO1G Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MYO1G |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MYO1G Antibody [NBP1-93704] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21645_MYO1G-Antibody-Western-Blot-NBP1-93704-img0006.jpg)
Western Blot: MYO1G Antibody [NBP1-93704] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4
![Immunohistochemistry-Paraffin: MYO1G Antibody [NBP1-93704] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21646_MYO1G%2520Antibody-Immunohistochemistry-Paraffin-NBP1-93704-img0002.jpg)
Immunohistochemistry-Paraffin: MYO1G Antibody [NBP1-93704] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.
![Simple Western: MYO1G Antibody [NBP1-93704] - Simple Western lane view shows a specific band for MYO1G in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21647_MYO1G-Antibody-Simple-Western-NBP1-93704-img0004.jpg)
Simple Western: MYO1G Antibody [NBP1-93704] - Simple Western lane view shows a specific band for MYO1G in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
![Simple Western: MYO1G Antibody [NBP1-93704] - Electropherogram image of the corresponding Simple Western lane view. MYO1G antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21648_MYO1G-Antibody-Simple-Western-NBP1-93704-img0005.jpg)
Simple Western: MYO1G Antibody [NBP1-93704] - Electropherogram image of the corresponding Simple Western lane view. MYO1G antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.