ZNF423 Antibody
| Name | ZNF423 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30695 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: CSVGSAKLESPVVQPTQSFMEVYSCPYCTNSPIFGSILKLTKHIKENHKNIPLAHSKKSKAEQSPVSSDVEVSSPKRQRLSASANSISNG |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF423 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: ZNF423 Antibody [NBP2-30695] - Immunofluorescent staining of human cell line A-431 shows positivity in nuclei. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29982_ZNF423-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-30695-img0003.jpg)
Immunocytochemistry/Immunofluorescence: ZNF423 Antibody [NBP2-30695] - Immunofluorescent staining of human cell line A-431 shows positivity in nuclei. Antibody staining is shown in green.
![Immunohistochemistry: ZNF423 Antibody [NBP2-30695] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/29983_ZNF423-Antibody-Immunohistochemistry-NBP2-30695-img0001.jpg)
Immunohistochemistry: ZNF423 Antibody [NBP2-30695] - Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells and glial cells.