VTI1A Antibody
| Name | VTI1A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-30952 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRILTGMLRRGCSVKKQCNLSLAPK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | VTI1A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | VTI1A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: VTI1A Antibody [NBP2-30952] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11650_VTI1A-Antibody-Western-Blot-NBP2-30952-img0002.jpg)
![Immunohistochemistry: VTI1A Antibody [NBP2-30952] - Staining of human stomach, lower shows moderate granular cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/11651_VTI1A-Antibody-Immunohistochemistry-NBP2-30952-img0001.jpg)