COPS4 Antibody

Name COPS4 Antibody
Supplier Novus Biologicals
Catalog NBP1-56646
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Horse, Guinea Pig
Antigen Synthetic peptide directed towards the middle region of human COPS4 (NP_057213). Peptide sequence YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHY
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene COPS4
Supplier Page Shop

Product images