Name | COPS4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-56646 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Horse, Guinea Pig |
Antigen | Synthetic peptide directed towards the middle region of human COPS4 (NP_057213). Peptide sequence YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHY |
Purity/Format | Affinity purified |
Description | Rabbit Polyclonal |
Gene | COPS4 |
Supplier Page | Shop |