MAGEA6 Antibody

Name MAGEA6 Antibody
Supplier Novus Biologicals
Catalog NBP1-56603
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MAGEA6(melanoma antigen family A, 6) The peptide sequence was selected from the middle region of MAGEA6. Peptide sequence APEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MAGEA6
Conjugate Unconjugated
Supplier Page Shop

Product images