MTHFS Antibody

Name MTHFS Antibody
Supplier Novus Biologicals
Catalog NBP1-56698
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MTHFS(5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)) The peptide sequence was selected from the middle region of MTHFS. Peptide sequence TSWNIPQPGEGDVREEALSTGGLDLIFMPGL
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MTHFS
Conjugate Unconjugated
Supplier Page Shop

Product images