C19orf21 Antibody
| Name | C19orf21 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-56743 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C19ORF21 The peptide sequence was selected from the C terminal of C19ORF21. Peptide sequence RRNALFPEVFSPTPDENSDQNSRSSSQASGITGSYSVSESPFFSPIHLHS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MISP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C19orf21 Antibody [NBP1-56743] - Sample Tissue: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7283_C19orf21-Antibody-Western-Blot-NBP1-56743-img0003.jpg)
Western Blot: C19orf21 Antibody [NBP1-56743] - Sample Tissue: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25ug/lane/lane, Gel Concentration: 12%
![Western Blot: C19orf21 Antibody [NBP1-56743] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7284_C19orf21-Antibody-Western-Blot-NBP1-56743-img0002.jpg)
Western Blot: C19orf21 Antibody [NBP1-56743] - HepG2 cell lysate, concentration 0.2-1 ug/ml.