HMGCLL1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-56833
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to HMGCLL1(3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase-like 1) The peptide sequence was selected from the N terminal of HMGCLL1. Peptide sequence MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: HMGCLL1
• Conjugate: Unconjugated