CTIF Antibody

Name CTIF Antibody
Supplier Novus Biologicals
Catalog NBP1-57319
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIAA0427(KIAA0427) The peptide sequence was selected from the N terminal of KIAA0427. Peptide sequence SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CTIF
Conjugate Unconjugated
Supplier Page Shop

Product images