BRUNOL6 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57256
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to BRUNOL6(bruno-like 6, RNA binding protein (Drosophila)) The peptide sequence was selected from the middle region of BRUNOL6. Peptide sequence QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CELF6
• Conjugate: Unconjugated