Name | UPF3B Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57233 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to UPF3B(UPF3 regulator of nonsense transcripts homolog B (yeast)) The peptide sequence was selected from the middle region of UPF3B (NP_542199) Peptide sequence KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | UPF3B |
Conjugate | Unconjugated |
Supplier Page | Shop |