UPF3B Antibody

Name UPF3B Antibody
Supplier Novus Biologicals
Catalog NBP1-57233
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UPF3B(UPF3 regulator of nonsense transcripts homolog B (yeast)) The peptide sequence was selected from the middle region of UPF3B (NP_542199) Peptide sequence KIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREKA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene UPF3B
Conjugate Unconjugated
Supplier Page Shop

Product images