Name | CTIF Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57423 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to KIAA0427(KIAA0427) The peptide sequence was selected from the N terminal of KIAA0427. Peptide sequence QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CTIF |
Conjugate | Unconjugated |
Supplier Page | Shop |