HORMAD2 Antibody

Name HORMAD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-52868
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HORMAD2(HORMA domain containing 2) The peptide sequence was selected from the middle region of HORMAD2. Peptide sequence YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HORMAD2
Conjugate Unconjugated
Supplier Page Shop

Product images