TRMT5 Antibody

Name TRMT5 Antibody
Supplier Novus Biologicals
Catalog NBP1-52876
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRMT5(TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TRMT5. Peptide sequence EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRMT5
Conjugate Unconjugated
Supplier Page Shop

Product images