TSSK2 Antibody

Name TSSK2 Antibody
Supplier Novus Biologicals
Catalog NBP1-52968
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TSSK2(testis-specific serine kinase 2) The peptide sequence was selected from the middle region of TSSK2. Peptide sequence RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TSSK2
Conjugate Unconjugated
Supplier Page Shop

Product images