POLR3H Antibody

Name POLR3H Antibody
Supplier Novus Biologicals
Catalog NBP1-53025
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to POLR3H(polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)) The peptide sequence was selected from the middle region of POLR3H. Peptide sequence AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene POLR3H
Conjugate Unconjugated
Supplier Page Shop

Product images