RIPK5 Antibody

Name RIPK5 Antibody
Supplier Novus Biologicals
Catalog NBP1-54845
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RIPK5(receptor interacting protein kinase 5) The peptide sequence was selected from the middle region of RIPK5. Peptide sequence EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DSTYK
Conjugate Unconjugated
Supplier Page Shop

Product images