UXT Antibody

Name UXT Antibody
Supplier Novus Biologicals
Catalog NBP1-54826
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to UXT(ubiquitously-expressed transcript) The peptide sequence was selected from the N terminal of UXT. Peptide sequence MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene UXT
Conjugate Unconjugated
Supplier Page Shop

Product images