RDH12 Antibody

Name RDH12 Antibody
Supplier Novus Biologicals
Catalog NBP1-57955
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RDH12(retinol dehydrogenase 12 (all-trans/9-cis/11-cis)) The peptide sequence was selected from the middle region of RDH12. Peptide sequence HIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRLQGTGVTTYAV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RDH12
Conjugate Unconjugated
Supplier Page Shop

Product images