RDH11 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57976
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to RDH11(retinol dehydrogenase 11 (all-trans/9-cis/11-cis)) The peptide sequence was selected from the C terminal of RDH11. Peptide sequence SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: RDH11
• Conjugate: Unconjugated