Name | IFIT5 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58887 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to IFIT5(interferon-induced protein with tetratricopeptide repeats 5) The peptide sequence was selected from the middle region of IFIT5. Peptide sequence ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | IFIT5 |
Conjugate | Unconjugated |
Supplier Page | Shop |