PTPLAD2 Antibody

Name PTPLAD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59414
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PTPLAD2(protein tyrosine phosphatase-like A domain containing 2) The peptide sequence was selected from the middle region of PTPLAD2. Peptide sequence LLHIYVGIESNHLLPRFLQLTERIIILFVVITSQEEVQEKYVVCVLFVFW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HACD4
Conjugate Unconjugated
Supplier Page Shop

Product images