Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody
| Name | Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58058 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HS3ST1(heparan sulfate (glucosamine) 3-O-sulfotransferase 1) The peptide sequence was selected from the middle region of HS3ST1. Peptide sequence TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HS3ST1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [NBP1-58058] - Titration: 0.2-1 ug/ml, Positive Control: Human Stomach.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15674_Heparan-Sulfate-3-O-Sulfotransferase-1-HS3ST1-Antibody-Western-Blot-NBP1-58058-img0004.jpg)
Western Blot: Heparan Sulfate 3-O-Sulfotransferase 1/HS3ST1 Antibody [NBP1-58058] - Titration: 0.2-1 ug/ml, Positive Control: Human Stomach.