POFUT2 Antibody
| Name | POFUT2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58053 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to POFUT2(protein O-fucosyltransferase 2) The peptide sequence was selected from the C terminal of POFUT2. Peptide sequence RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | POFUT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: POFUT2 Antibody [NBP1-58053] - HepG2 cell lysate, concentration 2.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24540_POFUT2-Antibody-Western-Blot-NBP1-58053-img0001.jpg)
![Immunohistochemistry-Paraffin: POFUT2 Antibody [NBP1-58053] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24541_POFUT2-Antibody-Immunohistochemistry-Paraffin-NBP1-58053-img0002.jpg)