ULBP-1 Antibody

Name ULBP-1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59052
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ULBP1(UL16 binding protein 1) The peptide sequence was selected from the N terminal of ULBP1. Peptide sequence MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ULBP1
Conjugate Unconjugated
Supplier Page Shop

Product images