KIAA0317 Antibody

Name KIAA0317 Antibody
Supplier Novus Biologicals
Catalog NBP1-59393
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Dog, Rabbit
Antigen Synthetic peptides corresponding to KIAA0317(KIAA0317) The peptide sequence was selected from the middle region of KIAA0317. Peptide sequence VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene AREL1
Supplier Page Shop

Product images