Name | KIAA0317 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59393 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Pig, Bovine, Dog, Rabbit |
Antigen | Synthetic peptides corresponding to KIAA0317(KIAA0317) The peptide sequence was selected from the middle region of KIAA0317. Peptide sequence VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | AREL1 |
Supplier Page | Shop |