Seladin 1 Antibody

Name Seladin 1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59369
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DHCR24(24-dehydrocholesterol reductase) The peptide sequence was selected from the N terminal of DHCR24. Peptide sequence FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DHCR24
Conjugate Unconjugated
Supplier Page Shop

Product images