Calsyntenin-3 Antibody
| Name | Calsyntenin-3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59713 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Guinea Pig |
| Antigen | Synthetic peptides corresponding to CLSTN3 (calsyntenin 3) The peptide sequence was selected from the N terminal of CLSTN3)(50ug). Peptide sequence QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CLSTN3 |
| Supplier Page | Shop |
Product images
![Western Blot: Calsyntenin-3 Antibody [NBP1-59713] - Titration: 0.2-1 ug/ml, Positive Control: RPMI 8226 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/3946_Calsyntenin-3%2520Antibody-Western%2520Blot-NBP1-59713-img0003.jpg)
Western Blot: Calsyntenin-3 Antibody [NBP1-59713] - Titration: 0.2-1 ug/ml, Positive Control: RPMI 8226 cell lysate.