SLC22A17 Antibody

Name SLC22A17 Antibody
Supplier Novus Biologicals
Catalog NBP1-59889
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC22A17(solute carrier family 22, member 17) The peptide sequence was selected from the middle region of SLC22A17. Peptide sequence HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC22A17
Conjugate Unconjugated
Supplier Page Shop

Product images