MCT1/SLC16A1 Antibody
| Name | MCT1/SLC16A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59879 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC16A1(solute carrier family 16, member 1 (monocarboxylic acid transporter 1)) The peptide sequence was selected from the middle region of SLC16A1. Peptide sequence EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQ |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC16A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MCT1/SLC16A1 Antibody [NBP1-59879] - HT1080 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24904_MCT1-SLC16A1-Antibody-Western-Blot-NBP1-59879-img0002.jpg)
Western Blot: MCT1/SLC16A1 Antibody [NBP1-59879] - HT1080 cell lysate, concentration 0.2-1 ug/ml.
![Immunocytochemistry/Immunofluorescence: MCT1/SLC16A1 Antibody [NBP1-59879] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Membrane and cytoplasmic; Primary Antibody Concentration: 1:100](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24905_MCT1-SLC16A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-59879-img0003.jpg)
Immunocytochemistry/Immunofluorescence: MCT1/SLC16A1 Antibody [NBP1-59879] - Formalin Fixed Paraffin; Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Membrane and cytoplasmic; Primary Antibody Concentration: 1:100