DNASE2B Antibody

Name DNASE2B Antibody
Supplier Novus Biologicals
Catalog NBP1-62279
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DNASE2B(deoxyribonuclease II beta) The peptide sequence was selected from the middle region of DNASE2B. Peptide sequence IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DNASE2B
Conjugate Unconjugated
Supplier Page Shop

Product images