EMP2 Antibody
| Name | EMP2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62705 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to EMP2(epithelial membrane protein 2) The peptide sequence was selected from the middle region of EMP2. Peptide sequence IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | EMP2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: EMP2 Antibody [NBP1-62705] - analysis of EMP2 in EMP2 overexpression lysate (Cat# NBL1-10260) and recombinant protein using anti-EMP2 antibody. Image from verified customer review.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25621_EMP2-Antibody-Western-Blot-NBP1-62705-img0005.jpg)
Western Blot: EMP2 Antibody [NBP1-62705] - analysis of EMP2 in EMP2 overexpression lysate (Cat# NBL1-10260) and recombinant protein using anti-EMP2 antibody. Image from verified customer review.
![Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-62705] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25622_EMP2-Antibody-Immunohistochemistry-Paraffin-NBP1-62705-img0003.jpg)
Immunohistochemistry-Paraffin: EMP2 Antibody [NBP1-62705] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.
![Western Blot: EMP2 Antibody [NBP1-62705] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25623_EMP2-Antibody-Western-Blot-NBP1-62705-img0004.jpg)
Western Blot: EMP2 Antibody [NBP1-62705] - HepG2 cell lysate, Antibody Titration: 1.25ug/ml