MARCH2 Antibody

Name MARCH2 Antibody
Supplier Novus Biologicals
Catalog NBP1-60051
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog
Antigen Synthetic peptides corresponding to MARCH2(membrane-associated ring finger (C3HC4) 2) The peptide sequence was selected from the middle region of 40239 (NP_001005415). Peptide sequence LFITPLAAISGWLCLRGAQDHLRLHSQLEAVGLIALTIALFTIYVLWTLV.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene MARCH2
Supplier Page Shop

Product images