SLC22A2/OCT2 Antibody

Name SLC22A2/OCT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59451
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Pig, Guinea Pig
Antigen Synthetic peptides corresponding to SLC22A2(solute carrier family 22 (organic cation transporter), member 2) The peptide sequence was selected from the N terminal of SLC22A2. Peptide sequence MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTP
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene SLC22A2
Supplier Page Shop

Product images