Name | SLC22A2/OCT2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59451 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Pig, Guinea Pig |
Antigen | Synthetic peptides corresponding to SLC22A2(solute carrier family 22 (organic cation transporter), member 2) The peptide sequence was selected from the N terminal of SLC22A2. Peptide sequence MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTP |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | SLC22A2 |
Supplier Page | Shop |