Name | BVES Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59647 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Pig, Bovine, Dog, Rabbit |
Antigen | Synthetic peptides corresponding to BVES(blood vessel epicardial substance) The peptide sequence was selected from the middle region of BVES. Peptide sequence YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | BVES |
Supplier Page | Shop |