BVES Antibody

Name BVES Antibody
Supplier Novus Biologicals
Catalog NBP1-59647
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Dog, Rabbit
Antigen Synthetic peptides corresponding to BVES(blood vessel epicardial substance) The peptide sequence was selected from the middle region of BVES. Peptide sequence YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene BVES
Supplier Page Shop

Product images