SLCO1A2 Antibody

Name SLCO1A2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59658
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Rabbit
Antigen Synthetic peptides corresponding to SLCO1A2(solute carrier organic anion transporter family, member 1A2) The peptide sequence was selected from the middle region of SLCO1A2. Peptide sequence AIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFL
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLCO1A2
Supplier Page Shop

Product images