SLC22A16 Antibody
| Name | SLC22A16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60040 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC22A16(solute carrier family 22 (organic cation transporter), member 16) The peptide sequence was selected from the N terminal of SLC22A16. Peptide sequence CSRNKRENTSSLGYEYTGSKKEFPCVDGYIYDQNTWKSTAVTQW |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC22A16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC22A16 Antibody [NBP1-60040] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24607_SLC22A16-Antibody-Western-Blot-NBP1-60040-img0001.jpg)
Western Blot: SLC22A16 Antibody [NBP1-60040] - HepG2 cell lysate, Antibody Titration: 2.5ug/ml
![Immunohistochemistry-Paraffin: SLC22A16 Antibody [NBP1-60040] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24608_SLC22A16-Antibody-Immunohistochemistry-Paraffin-NBP1-60040-img0002.jpg)
Immunohistochemistry-Paraffin: SLC22A16 Antibody [NBP1-60040] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.