SUSD4 Antibody
| Name | SUSD4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59974 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Bovine, Horse |
| Antigen | Synthetic peptides corresponding to SUSD4(sushi domain containing 4) The peptide sequence was selected from the N terminal of SUSD4. Peptide sequence MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SUSD4 |
| Supplier Page | Shop |
Product images
![Western Blot: SUSD4 Antibody [NBP1-59974] - Human Lung lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/4050_SUSD4%2520Antibody-Western%2520Blot-NBP1-59974-img0002.jpg)
Western Blot: SUSD4 Antibody [NBP1-59974] - Human Lung lysate, concentration 0.2-1 ug/ml.