PTDSS1 Antibody

Name PTDSS1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59966
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PTDSS1(phosphatidylserine synthase 1) The peptide sequence was selected from the N terminal of PTDSS1. Peptide sequence MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PTDSS1
Conjugate Unconjugated
Supplier Page Shop

Product images