SLC17A3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-60014
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC17A3(solute carrier family 17 (sodium phosphate), member 3) The peptide sequence was selected from the middle region of SLC17A3. Peptide sequence FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC17A3
• Conjugate: Unconjugated