Name | SLC17A3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-60014 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC17A3(solute carrier family 17 (sodium phosphate), member 3) The peptide sequence was selected from the middle region of SLC17A3. Peptide sequence FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC17A3 |
Conjugate | Unconjugated |
Supplier Page | Shop |