PIGW Antibody

Name PIGW Antibody
Supplier Novus Biologicals
Catalog NBP1-60017
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PIGW(phosphatidylinositol glycan anchor biosynthesis, class W) The peptide sequence was selected from the middle region of PIGW. Peptide sequence IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PIGW
Conjugate Unconjugated
Supplier Page Shop

Product images