CCBL2 Antibody
| Name | CCBL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70487 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RP11-82K18.3 The peptide sequence was selected from the N terminal of RP11-82K18.3. Peptide sequence SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CCBL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CCBL2 Antibody [NBP1-70487] - Antibody Titration: 2.5 ug/ml Positive control: Jurkat cell lysate CCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7014_CCBL2%2520Antibody-Western%2520Blot-NBP1-70487-img0003.jpg)
Western Blot: CCBL2 Antibody [NBP1-70487] - Antibody Titration: 2.5 ug/ml Positive control: Jurkat cell lysate CCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat.