ANO3 Antibody

Name ANO3 Antibody
Supplier Novus Biologicals
Catalog NBP1-70410
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMEM16C(transmembrane protein 16C) The peptide sequence was selected from the C terminal of TMEM16C. Peptide sequence AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANO3
Conjugate Unconjugated
Supplier Page Shop

Product images