SGEF Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-70702
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SGEF(Src homology 3 domain-containing guanine nucleotide exchange factor) The peptide sequence was selected from the N terminal of SGEF. Peptide sequence MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLIT
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ARHGEF26
• Conjugate: Unconjugated