Tryptase epsilon/BSSP-4/PRSS22 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-70688
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PRSS22 (protease, serine, 22) The peptide sequence was selected from the N terminal of PRSS22)(50ug). Peptide sequence IPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRW.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: PRSS22
• Conjugate: Unconjugated